Pfam domain
Pfam family: HhH-GPD (PF00730.27)
Uniprot AC: P83847
RecName: Adenine DNA glycosylase
Begin-End: 41-176
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
VSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVK
EVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDD
IAKPSTRKRFEQIVRE
Structures of the domain P83847 41-176
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rrs X-ray 2.4 A 41-176  H-Bb L-Bb L-Mj L-Mn 
1rrq X-ray 2.22 A 41-177  H-Bb L-Bb L-Mj L-Mn 
5kn8 X-ray 1.81 A 41-177  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
4yoq X-ray 2.21 A 41-177  H-Bb L-Bb L-Mj L-Mn 
1vrl X-ray 2.5 A 41-176  H-Bb L-Bb L-Mj L-Mn 
4yph X-ray 2.32 A 41-177  H-Bb L-Bb L-Mj L-Mn 
4ypr X-ray 2.59 B 41-177  H-Bb L-Bb L-Mj L-Mn 
4ypr X-ray 2.59 A 41-177  H-Bb H-Mj L-Bb L-Mj L-Mn 
3g0q X-ray 2.2 A 41-177  H-Bb L-Bb L-Mj L-Mn 
6q0c X-ray 2 A 41-176  H-Bb L-Bb L-Mj L-Mn 
5kn9 X-ray 1.93 A 41-177  H-Bb H-Mj L-Bb L-Mj L-Mn 
6u7t X-ray 2 A 41-176  H-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text