Pfam domain
Pfam family: DIM1 (PF02966.15)
Uniprot AC: P83876
RecName: Thioredoxin-like protein 4A
Begin-End: 4-136
Organism: Homo sapiens
Interaction Mode:   

Sequence:
MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDI
TEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGA
RKGRGLVVSPKDY
Structures of the domain P83876 4-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jcr X-ray 7 E 4-136 None
5o9z X-ray 4.5 J 16-136 None


© NPIDB team 2003 - 2019

text