Pfam domain
Pfam family: MH1 (PF03165.18)
Uniprot AC: P84022
RecName: Mothers against decapentaplegic homolog 3
Begin-End: 31-131
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
CEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCR
LWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVE
Structures of the domain P84022 31-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mhd X-ray 2.8 B 31-131  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mhd X-ray 2.8 A 31-131  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ozj X-ray 2.4 B 31-131  H-Bb S-Bb S-Mj L-Bb L-Mj 
1ozj X-ray 2.4 A 31-131  H-Bb S-Bb S-Mj L-Bb L-Mj 
6zmn X-ray 2.33 B 28-127  H-Bb S-Bb S-Mj L-Bb L-Mj 
6zmn X-ray 2.33 A 28-128 None
5odg X-ray 2.12 A 31-131  S-Bb S-Mj L-Bb L-Mj 
5odg X-ray 2.12 B 31-131 None
5od6 X-ray 2 B 31-131 None
5od6 X-ray 2 A 31-131  S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text