Pfam domain
Pfam family: CENP-T_C (PF15511.5)
Uniprot AC: P84040
RecName: Histone H4
Begin-End: 23-99
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTV
TAMDVVYALKRQGRTLY
Structures of the domain P84040 23-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pyo X-ray 2.43 B 34-95 None
4qlc X-ray 3.5 B 35-95  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 F 34-95  H-Bb S-Bb L-Bb 
2nqb X-ray 2.3 B 35-95  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 F 35-95  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 B 35-95  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 P 35-95  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 L 35-95  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text