Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84051
RecName: Histone H2A
Begin-End: 14-90
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb 

Sequence:
AKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLELAGNAARDN
KKTRIIPRHLQLAIRND
Structures of the domain P84051 14-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2pyo X-ray 2.43 G 14-87 None
2pyo X-ray 2.43 C 15-87 None
4qlc X-ray 3.5 C 16-87  H-Bb S-Bb L-Bb 
4qlc X-ray 3.5 G 15-87  H-Bb S-Bb L-Bb 
2nqb X-ray 2.3 G 1016-1088  H-Bb S-Bb L-Bb 
2nqb X-ray 2.3 C 816-888  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 G 17-87  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 C 17-87  H-Bb S-Bb L-Bb 
4x23 X-ray 3.5 Q 17-87  H-Bb S-Bb S-Mn L-Bb 
4x23 X-ray 3.5 M 17-87  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text