Pfam domain
Pfam family: RRF (PF01765.18)
Uniprot AC: P84154
RecName: Ribosome-recycling factor
Begin-End: 20-183
Organism: Escherichia coli
Interaction Mode:   

Sequence:
IEDELRKMRTGKPSPAILEEIKVDYYGVPTPVNQLATISISEERTLVIKPWDKSVLSLIE
KAINASDLGLNPINDGNVIRLVFPSPTTEQREKWVKKAKEIVEEGKIAIRNIRREILKKI
KEDQKEGLIPEDDAKRLENEIQKLTDEFIEKLDEVFEIKKEEIM
Structures of the domain P84154 20-183
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1t1m X-ray 12 C 20-182 None


© NPIDB team 2003 - 2019

text