Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84229
RecName: Histone H3.2
Begin-End: 30-132
Organism: Gallus gallus
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
APATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSA
VMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84229 30-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1eqz X-ray 2.5 C 34-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text