Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 2-132
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM
PKDIQLARRIR
Structures of the domain P84233 2-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1kx5 X-ray 1.94 E 1-131 None
1kx5 X-ray 1.94 A 1-131 None


© NPIDB team 2003 - 2019

text