Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 34-132
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
GGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMAL
QEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84233 34-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p3i X-ray 2.3 E 634-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3b6f X-ray 3.45 E 35-131 None
3b6f X-ray 3.45 A 36-131 None
3b6g X-ray 3.45 A 36-131 None
3b6g X-ray 3.45 E 35-131 None
1f66 X-ray 2.6 E 635-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1f66 X-ray 2.6 A 436-531  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text