Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 37-132
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA
SEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84233 37-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wu8 X-ray 2.45 E 38-131 None
4wu8 X-ray 2.45 A 38-131 None
4wu9 X-ray 2.6 E 38-131 None
4wu9 X-ray 2.6 A 38-131 None
6kix X-ray 4.1 E 38-131  H-Bb L-Bb L-Mn 
6kix X-ray 4.1 A 38-131  H-Bb L-Bb L-Mn 
3kwq X-ray 3.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3kwq X-ray 3.5 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3mgr X-ray 2.3 E 37-131 None
3mgr X-ray 2.3 A 37-131 None
5o9g X-ray 4.8 E 39-131 None
5o9g X-ray 4.8 A 38-131 None
6ryr X-ray 3.1 A 38-131 None
6ryr X-ray 3.1 E 39-131 None
3mgq X-ray 2.65 E 37-131 None
3mgq X-ray 2.65 A 37-131 None
2f8n X-ray 2.9 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
2f8n X-ray 2.9 A 438-531  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
6fq6 X-ray 4 E 37-131 None
6fq6 X-ray 4 A 37-131 None
5onw X-ray 2.8 E 39-131 None
5onw X-ray 2.8 A 39-131 None
3uta X-ray 2.07 E 38-131 None
3uta X-ray 2.07 A 38-131 None
5oy7 X-ray 5.77 M 39-131 None
5oy7 X-ray 5.77 c 16-108 None
5oy7 X-ray 5.77 Q 38-131 None
5oy7 X-ray 5.77 I 38-131 None
5oy7 X-ray 5.77 A 16-109 None
5oy7 X-ray 5.77 E 39-131 None
5oy7 X-ray 5.77 U 39-131 None
5oy7 X-ray 5.77 Y 38-131 None
5dnm X-ray 2.81 E 38-131 None
5dnm X-ray 2.81 A 38-131 None
5dnn X-ray 2.8 E 38-131 None
5dnn X-ray 2.8 A 38-131 None
6pww X-ray 4.4 G 37-131  H-Bb S-Bb L-Bb L-Mn 
6pww X-ray 4.4 K 37-131  H-Bb S-Bb L-Bb L-Mn 
6kw4 X-ray 7.55 Q 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6kw4 X-ray 7.55 N 37-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
2fj7 X-ray 3.2 A 38-131  H-Bb S-Bb S-Mn L-Bb L-Mj L-Mn 
2fj7 X-ray 3.2 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mj 
5nl0 X-ray 5.4 K 38-131 None
5nl0 X-ray 5.4 E 38-131 None
5nl0 X-ray 5.4 A 38-131 None
3kuy X-ray 2.9 E 38-131 None
3kuy X-ray 2.9 A 38-131 None
3c1c X-ray 3.15 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3c1c X-ray 3.15 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4j8v X-ray 2.58 E 38-131 None
4j8v X-ray 2.58 A 38-131 None
4j8v X-ray 2.58 E 38-131 None
4j8v X-ray 2.58 A 38-131 None
4j8x X-ray 2.87 E 38-131 None
4j8x X-ray 2.87 A 38-131 None
4j8x X-ray 2.87 E 38-131 None
4j8x X-ray 2.87 A 38-131 None
5z3u X-ray 4.31 A 37-131  H-Bb H-Mj S-Bb L-Bb 
5z3u X-ray 4.31 E 40-131  H-Bb S-Bb L-Bb 
3lel X-ray 2.95 A 38-131 None
3lel X-ray 2.95 E 38-131 None
3lel X-ray 2.95 O 38-131 None
3lel X-ray 2.95 K 37-131 None
2nzd X-ray 2.65 A 38-131 None
2nzd X-ray 2.65 E 38-131 None
5e5a X-ray 2.81 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5e5a X-ray 2.81 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4ys3 X-ray 3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
4ys3 X-ray 3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
3b6f X-ray 3.45 A 33-131 None
3b6g X-ray 3.45 A 33-131 None
3o62 X-ray 3.22 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3o62 X-ray 3.22 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3rei X-ray 2.65 E 38-131 None
3rei X-ray 2.65 A 38-131 None
6ne3 X-ray 3.9 E 37-131  H-Bb S-Bb L-Bb L-Mn 
6ne3 X-ray 3.9 A 36-131  H-Bb L-Bb L-Mn 
5mlu X-ray 2.8 E 39-131 None
5mlu X-ray 2.8 A 39-131 None
1s32 X-ray 2.05 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1s32 X-ray 2.05 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
6nog X-ray 3.9 A 38-131  H-Bb S-Bb L-Bb L-Mn 
6nog X-ray 3.9 E 38-131  H-Bb S-Bb L-Bb 
6kiu X-ray 3.2 E 38-131  H-Bb L-Bb L-Mn 
6kiu X-ray 3.2 A 38-131  H-Bb L-Bb L-Mn 
3tu4 X-ray 3 E 40-131  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 A 37-131  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 E 40-131  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 A 37-131  H-Bb H-Mj S-Bb L-Bb 
3reh X-ray 2.5 A 38-131 None
3reh X-ray 2.5 E 38-131 None
5hq2 X-ray 4.5 A 37-131 None
3mvd X-ray 2.9 E 40-131  H-Bb H-Mj S-Bb L-Bb 
3mvd X-ray 2.9 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6jm9 X-ray 7.3 E 38-131 None
6jm9 X-ray 7.3 A 38-131 None
3utb X-ray 2.2 E 39-131 None
3utb X-ray 2.2 A 38-131 None
3lz0 X-ray 2.5 A 38-131 None
3lz0 X-ray 2.5 E 39-131 None
3mgp X-ray 2.44 E 37-131 None
3mgp X-ray 2.44 A 37-131 None
3rej X-ray 2.55 A 38-131 None
3rej X-ray 2.55 E 39-131 None
3rek X-ray 2.6 E 39-131 None
3rek X-ray 2.6 A 38-131 None
3rel X-ray 2.7 E 39-131 None
3rel X-ray 2.7 A 38-131 None
4xzq X-ray 2.4 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4xzq X-ray 2.4 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3lz1 X-ray 2.5 E 39-131 None
3lz1 X-ray 2.5 A 38-131 None
4ld9 X-ray 3.31 A 37-131 None
6esg X-ray 5.4 A 38-131 None
3ut9 X-ray 2.2 E 38-131 None
3ut9 X-ray 2.2 A 38-131 None
6esi X-ray 6.3 A 37-131 None
4kgc X-ray 2.69 E 38-131 None
4kgc X-ray 2.69 A 38-131 None
6ryu X-ray 4 A 38-131 None
6ryu X-ray 4 E 39-131 None
4r8p X-ray 3.28 E 38-131 None
4r8p X-ray 3.28 A 37-131 None
3c1b X-ray 2.2 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
3c1b X-ray 2.2 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3lja X-ray 2.75 E 37-131 None
3lja X-ray 2.75 A 37-131 None
1zbb X-ray 9 e 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
1zbb X-ray 9 a 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
1zbb X-ray 9 E 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
1zbb X-ray 9 A 39-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4xuj X-ray 3.18 E 38-131 None
4xuj X-ray 3.18 A 38-131 None
6fq5 X-ray 3.8 E 38-131 None
6fq5 X-ray 3.8 A 37-131 None
6pa7 X-ray 2.94 E 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6pa7 X-ray 2.94 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6o96 X-ray 3.5 E 37-131  H-Bb S-Bb L-Bb L-Mn 
6o96 X-ray 3.5 A 37-131  H-Bb S-Bb L-Bb L-Mn 
5f99 X-ray 2.63 E 37-131 None
5f99 X-ray 2.63 A 36-131 None
6kw3 X-ray 7.13 Q 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6kw3 X-ray 7.13 N 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z3o X-ray 3.62 E 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z3o X-ray 3.62 A 37-131  H-Bb S-Bb L-Bb L-Mn 
5cp6 X-ray 2.6 E 38-131 None
5cp6 X-ray 2.6 A 38-131 None
5omx X-ray 2.32 A 38-131 None
5omx X-ray 2.32 E 37-131 None
5ong X-ray 2.8 E 39-131 None
5ong X-ray 2.8 A 39-131 None
4z66 X-ray 2.5 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4z66 X-ray 2.5 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r1t X-ray 3.7 E 37-131 None
6r1t X-ray 3.7 A 37-131 None
6x0n X-ray 10 A 37-131 None
6x0n X-ray 10 e 37-129 None
6x0n X-ray 10 a 37-130 None
6x0n X-ray 10 E 37-131 None
6iy3 X-ray 3.67 E 37-131  H-Bb S-Bb L-Bb L-Mn 
6iy3 X-ray 3.67 A 36-131  H-Bb L-Bb L-Mn 
5xf6 X-ray 2.63 E 38-131 None
5xf6 X-ray 2.63 A 38-131 None
6iro X-ray 3.4 E 40-131  H-Bb S-Bb L-Bb L-Mn 
6iro X-ray 3.4 A 37-131  H-Bb S-Bb L-Bb L-Mn 
6pwv X-ray 6.2 G 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6pwv X-ray 6.2 K 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4zux X-ray 3.82 O 39-131 None
4zux X-ray 3.82 K 38-131 None
4zux X-ray 3.82 E 0-92 None
4zux X-ray 3.82 A 38-131 None
6iy2 X-ray 3.47 A 36-131  H-Bb H-Mj L-Bb L-Mn 
6iy2 X-ray 3.47 E 37-131  H-Bb S-Bb L-Bb L-Mn 
6uxw X-ray 8.96 V 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6uxw X-ray 8.96 R 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r25 X-ray 4.61 E 36-131 None
6r25 X-ray 4.61 A 37-131 None
6i84 X-ray 4.4 M 38-131  H-Bb H-Mj 
6i84 X-ray 4.4 S 39-131  H-Bb H-Mj L-Mj L-Mn 
5oxv X-ray 6.72 E 39-131 None
5oxv X-ray 6.72 K 38-131 None
5oxv X-ray 6.72 O 39-131 None
5oxv X-ray 6.72 A 38-131 None
6esh X-ray 5.1 E 39-131 None
6esh X-ray 5.1 A 37-131 None
1zla X-ray 2.9 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1zla X-ray 2.9 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3mnn X-ray 2.5 E 38-131 None
3mnn X-ray 2.5 A 38-131 None
6nn6 X-ray 3.9 A 38-131 None
6nn6 X-ray 3.9 E 39-131 None
6esf X-ray 3.7 E 37-131 None
6esf X-ray 3.7 A 37-131 None
6ven X-ray 3.37 E 38-131  H-Bb H-Mj L-Bb 
6r1u X-ray 4.36 A 37-131 None
6r1u X-ray 4.36 E 36-131 None
6kiz X-ray 4.5 E 38-131  H-Bb S-Bb L-Bb L-Mn 
6kiz X-ray 4.5 A 38-131  H-Bb L-Bb L-Mn 
3mgs X-ray 3.15 E 37-131 None
3mgs X-ray 3.15 A 37-131 None
6t9l X-ray 3.6 E 40-131 None
6t9l X-ray 3.6 A 38-131 None
6pwx X-ray 4.2 K 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6pwx X-ray 4.2 G 37-131  H-Bb H-Mj S-Bb L-Bb 
1f66 X-ray 2.6 A 436-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1f66 X-ray 2.6 E 633-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1kx3 X-ray 2 E 38-131 None
1kx3 X-ray 2 A 38-131 None
1kx4 X-ray 2.6 E 39-131 None
1kx4 X-ray 2.6 A 38-131 None
1p34 X-ray 2.7 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p34 X-ray 2.7 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3a X-ray 3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3a X-ray 3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3b X-ray 3 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3b X-ray 3 A 437-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3f X-ray 2.9 A 437-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3f X-ray 2.9 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3g X-ray 2.7 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3g X-ray 2.7 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3i X-ray 2.3 E 632-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3i X-ray 2.3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3k X-ray 2.9 A 439-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3k X-ray 2.9 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3l X-ray 2.4 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3l X-ray 2.4 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3m X-ray 2.9 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3m X-ray 2.9 A 437-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3o X-ray 2.75 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3o X-ray 2.75 E 639-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3p X-ray 2.7 E 636-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3p X-ray 2.7 A 436-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4j8u X-ray 2.38 E 38-131 None
4j8u X-ray 2.38 A 38-131 None
6kw5 X-ray 10.13 V 40-131  H-Bb L-Bb L-Mn 
6kw5 X-ray 10.13 R 39-131  H-Bb H-Mj S-Bb S-Mn L-Bb 
6tda X-ray 15 E 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6tda X-ray 15 A 39-131  H-Bb H-Mj S-Bb L-Bb 
6om3 X-ray 3.3 A 38-131  H-Bb S-Bb L-Bb L-Mj L-Mn 
6om3 X-ray 3.3 E 40-131  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 Q 40-131  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 M 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6nqa X-ray 3.54 A 38-131  H-Bb L-Bb 
6nqa X-ray 3.54 E 37-131  H-Bb L-Bb 
4j8w X-ray 2.41 E 38-131 None
4j8w X-ray 2.41 A 38-131 None
5kgf X-ray 4.54 E 36-131 None
5kgf X-ray 4.54 A 35-131 None
5x0y X-ray 4.69 E 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5x0y X-ray 4.69 A 37-131  H-Bb H-Mj L-Bb L-Mn 
6s01 X-ray 3.2 E 38-131 None
6s01 X-ray 3.2 A 35-131 None
5x0x X-ray 3.97 E 40-131  H-Bb S-Bb L-Bb L-Mn 
5x0x X-ray 3.97 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6kiw X-ray 4 E 38-131  H-Bb S-Bb L-Bb L-Mn 
6kiw X-ray 4 A 38-131  H-Bb L-Bb 
5z3v X-ray 4.22 E 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z3v X-ray 4.22 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
6jma X-ray 6.8 E 38-131 None
6jma X-ray 6.8 A 38-131 None
6kiv X-ray 4 E 38-131  H-Bb L-Bb L-Mn 
6kiv X-ray 4 A 38-131  H-Bb S-Bb L-Bb L-Mn 
5z3l X-ray 4.31 E 40-131  H-Bb H-Mj S-Bb L-Bb 
5z3l X-ray 4.31 A 37-131  H-Bb S-Bb L-Bb 
7at8 X-ray 4.4 H 40-131 None
6wz9 X-ray 2.8 A 39-131 None
6wz9 X-ray 2.8 E 39-131 None
6wz5 X-ray 2.2 A 37-131 None
6wz5 X-ray 2.2 E 37-131 None
6nj9 X-ray 2.96 A 37-131  H-Bb H-Mj L-Bb L-Mn 
6nj9 X-ray 2.96 E 37-131  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text