Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 39-132
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84233 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p3f X-ray 2.9 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3f X-ray 2.9 A 437-531  H-Bb S-Bb L-Bb L-Mn 
3kwq X-ray 3.5 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3kwq X-ray 3.5 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3mgr X-ray 2.3 E 37-131 None
3mgr X-ray 2.3 A 37-131 None
1p3i X-ray 2.3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1kx4 X-ray 2.6 E 39-131 None
1kx4 X-ray 2.6 A 38-131 None
4j8v X-ray 2.58 A 38-131 None
4j8v X-ray 2.58 E 38-131 None
4j8v X-ray 2.58 E 38-131 None
4j8v X-ray 2.58 A 38-131 None
3c1c X-ray 3.15 A 438-531  H-Bb S-Bb L-Bb L-Mn 
3c1c X-ray 3.15 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1kx3 X-ray 2 E 38-131 None
1kx3 X-ray 2 A 38-131 None
3c1b X-ray 2.2 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3c1b X-ray 2.2 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p34 X-ray 2.7 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p34 X-ray 2.7 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3uta X-ray 2.07 E 38-131 None
3uta X-ray 2.07 A 38-131 None
3utb X-ray 2.2 E 39-131 None
3utb X-ray 2.2 A 38-131 None
5omx X-ray 2.32 A 38-131 None
5omx X-ray 2.32 E 37-131 None
1p3g X-ray 2.7 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3g X-ray 2.7 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4j8x X-ray 2.87 A 38-131 None
4j8x X-ray 2.87 E 38-131 None
4j8x X-ray 2.87 A 38-131 None
4j8x X-ray 2.87 E 38-131 None
1p3a X-ray 3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3a X-ray 3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3o X-ray 2.75 E 639-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3o X-ray 2.75 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3m X-ray 2.9 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3m X-ray 2.9 A 437-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
6esi X-ray 6.3 A 37-131 None
3kxb X-ray 3.2 A 42-131  H-Bb H-Mj 
3kuy X-ray 2.9 E 38-131 None
3kuy X-ray 2.9 A 38-131 None
1p3p X-ray 2.7 A 436-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3p X-ray 2.7 E 636-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3b X-ray 3 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3b X-ray 3 A 437-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
3lel X-ray 2.95 A 38-131 None
3lel X-ray 2.95 E 38-131 None
3lel X-ray 2.95 O 38-131 None
3lel X-ray 2.95 K 37-131 None
3tu4 X-ray 3 E 40-131  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 A 37-131  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 E 40-131  H-Bb H-Mj S-Bb L-Bb 
3tu4 X-ray 3 A 37-131  H-Bb H-Mj S-Bb L-Bb 
1p3k X-ray 2.9 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3k X-ray 2.9 A 439-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
2f8n X-ray 2.9 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
2f8n X-ray 2.9 A 438-531  H-Bb S-Bb L-Bb L-Mn 
2nzd X-ray 2.65 A 38-131 None
2nzd X-ray 2.65 E 38-131 None
4xzq X-ray 2.4 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
4xzq X-ray 2.4 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4wu9 X-ray 2.6 E 38-131 None
4wu9 X-ray 2.6 A 38-131 None
1p3l X-ray 2.4 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1p3l X-ray 2.4 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4ys3 X-ray 3 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
4ys3 X-ray 3 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
3mvd X-ray 2.9 E 40-131  H-Bb H-Mj S-Bb L-Bb 
3mvd X-ray 2.9 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3o62 X-ray 3.22 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3o62 X-ray 3.22 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
4kgc X-ray 2.69 E 38-131 None
4kgc X-ray 2.69 A 38-131 None
1s32 X-ray 2.05 E 637-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1s32 X-ray 2.05 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
2fj7 X-ray 3.2 A 38-131  H-Bb S-Bb S-Mn L-Bb L-Mj L-Mn 
2fj7 X-ray 3.2 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mj 
3rek X-ray 2.6 E 39-131 None
3rek X-ray 2.6 A 38-131 None
5x0x X-ray 3.97 E 40-131  H-Bb S-Bb L-Bb L-Mn 
5x0x X-ray 3.97 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5nl0 X-ray 5.4 A 38-131 None
5nl0 X-ray 5.4 E 38-131 None
5nl0 X-ray 5.4 K 38-131 None
5mlu X-ray 2.8 E 39-131 None
5mlu X-ray 2.8 A 39-131 None
3reh X-ray 2.5 E 38-131 None
3reh X-ray 2.5 A 38-131 None
3rel X-ray 2.7 A 38-131 None
3rel X-ray 2.7 E 39-131 None
3rej X-ray 2.55 E 39-131 None
3rej X-ray 2.55 A 38-131 None
1zla X-ray 2.9 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
1zla X-ray 2.9 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
3rei X-ray 2.65 E 38-131 None
3rei X-ray 2.65 A 38-131 None
3lz0 X-ray 2.5 E 39-131 None
3lz0 X-ray 2.5 A 38-131 None
3ut9 X-ray 2.2 E 38-131 None
3ut9 X-ray 2.2 A 38-131 None
5ong X-ray 2.8 E 41-131 None
5ong X-ray 2.8 A 41-131 None
3lz1 X-ray 2.5 E 39-131 None
3lz1 X-ray 2.5 A 38-131 None
4ld9 X-ray 3.31 A 37-131 None
4j8u X-ray 2.38 A 38-131 None
4j8u X-ray 2.38 E 38-131 None
4j8u X-ray 2.38 E 38-131 None
4j8u X-ray 2.38 A 38-131 None
3lja X-ray 2.75 A 37-131 None
3lja X-ray 2.75 E 37-131 None
4r8p X-ray 3.28 E 38-131 None
4r8p X-ray 3.28 A 37-131 None
5onw X-ray 2.8 E 41-131 None
5onw X-ray 2.8 A 41-131 None
5e5a X-ray 2.81 A 37-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5e5a X-ray 2.81 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5xf6 X-ray 2.63 A 38-131 None
5xf6 X-ray 2.63 E 38-131 None
5kgf X-ray 4.54 E 36-131 None
5kgf X-ray 4.54 A 36-131 None
5x0y X-ray 4.69 E 40-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5x0y X-ray 4.69 A 37-131  H-Bb H-Mj L-Bb L-Mn 
4wu8 X-ray 2.45 E 38-131 None
4wu8 X-ray 2.45 A 38-131 None
5f99 X-ray 2.63 E 37-131 None
5f99 X-ray 2.63 A 36-131 None
3mgq X-ray 2.65 E 37-131 None
3mgq X-ray 2.65 A 37-131 None
6esf X-ray 3.7 A 37-131 None
6esf X-ray 3.7 E 37-131 None
4zux X-ray 3.82 E 39-131 None
4zux X-ray 3.82 A 38-131 None
4zux X-ray 3.82 O 39-131 None
4zux X-ray 3.82 K 38-131 None
5dnm X-ray 2.81 E 38-131 None
5dnm X-ray 2.81 A 38-131 None
3mgp X-ray 2.44 E 37-131 None
3mgp X-ray 2.44 A 37-131 None
3mnn X-ray 2.5 E 38-131 None
3mnn X-ray 2.5 A 38-131 None
4xuj X-ray 3.18 E 38-131 None
4xuj X-ray 3.18 A 38-131 None
6esh X-ray 5.1 E 39-131 None
6esh X-ray 5.1 A 37-131 None
5o9g X-ray 4.8 E 39-131 None
5o9g X-ray 4.8 A 38-131 None
4j8w X-ray 2.41 A 38-131 None
4j8w X-ray 2.41 E 38-131 None
4j8w X-ray 2.41 A 38-131 None
4j8w X-ray 2.41 E 38-131 None
4z66 X-ray 2.5 E 638-731  H-Bb H-Mj S-Bb L-Bb L-Mn 
4z66 X-ray 2.5 A 438-531  H-Bb H-Mj S-Bb L-Bb L-Mn 
3mgs X-ray 3.15 E 37-131 None
3mgs X-ray 3.15 A 37-131 None
5dnn X-ray 2.8 E 38-131 None
5dnn X-ray 2.8 A 38-131 None
5cp6 X-ray 2.6 E 38-131 None
5cp6 X-ray 2.6 A 38-131 None
6esg X-ray 5.4 E 42-131 None
6esg X-ray 5.4 A 38-131 None


© NPIDB team 2003 - 2019

text