Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84233
RecName: Histone H3.2
Begin-End: 46-132
Organism: Xenopus laevis
Interaction Mode:  H-Bb H-Mj 

Sequence:
TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLF
EDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84233 46-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6esi X-ray 6.3 E 48-131 None
3kxb X-ray 3.2 E 45-131  H-Bb H-Mj 
4ld9 X-ray 3.31 E 44-131 None


© NPIDB team 2003 - 2019

text