Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P84243
RecName: Histone H3.3
Begin-End: 39-132
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASE
AYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR
Structures of the domain P84243 39-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x7x X-ray 2.18 E 36-131  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mn 
5x7x X-ray 2.18 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5ay8 X-ray 2.8 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5ay8 X-ray 2.8 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3av2 X-ray 2.8 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3av2 X-ray 2.8 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wtp X-ray 2.67 E 36-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b33 X-ray 2.93 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b33 X-ray 2.93 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b32 X-ray 2.35 E 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 
5b32 X-ray 2.35 A 38-131  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text