Pfam domain
Pfam family: Pro_isomerase (PF00160.20)
Uniprot AC: P87051
RecName: Peptidyl-prolyl cis-trans isomerase ppi1
Begin-End: 3-154
Organism: Schizosaccharomyces pombe
Interaction Mode:   

Sequence:
NVELQTSLGKILIELYTEHAPKTCQNFYTLAKEGYYDGVIFHRVIPDFVIQGGDPTGTGR
GGTSIYGDKFDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPTPWLDGKHTIFGRV
VSGLSVCKRMGLIRTDSSDRPIEPLKIIKAVA
Structures of the domain P87051 3-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3jb9 X-ray 3.6 d 4-152 None


© NPIDB team 2003 - 2019

text