Pfam domain
Pfam family: CBFB_NFYA (PF02045.14)
Uniprot AC: P87249
RecName: HAPB protein
Begin-End: 232-288
Organism: Emericella nidulans
Interaction Mode:  H-Bb H-Mn S-Bb S-Mj S-Mn L-Bb L-Mn 

Sequence:
SPLYVNAKQFHRILKRRVARQKLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRF
Structures of the domain P87249 232-288
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4g92 X-ray 1.8 A 233-288  H-Bb H-Mn S-Bb S-Mj S-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2019

text