Pfam domain
Pfam family: tRNA-synt_1 (PF00133.21)
Uniprot AC: P96142
RecName: Valine--tRNA ligase
Begin-End: 13-568
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
EPKWAEKWAKNPFVANPKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGF
EAVWLPGTDHAGIATQVVVERLLLKEGKTRHDLGREKFLERVWQWKEESGGTILKQLKRL
GASADWSREAFTMDEKRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEVETEP
TPGKLYTLRYEVEGGGFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPLTEVWI
PILADPAVEKDFGTGALKVTPAHDPLDYEIGERHGLKPVSVINLEGRMEGERVPEALRGL
DRFEARRKAVELFREAGHLVKEEDYTIALATCSRCGTPIEYAIFPQWWLRMRPLAEEVLK
GLRRGDIAFVPERWKKVNMDWLENVKDWNISRQLWWGHQIPAWYCEDCQAVNVPRPERYL
EDPTSCEACGSPRLKRDEDVFDTWFSSALWPLSTLGWPEETEDLKAFYPGDVLVTGYDIL
FLWVSRMEVSGYHFMGERPFKTVLLHGLVLDEKGQKMSKSKGNVIDPLEMVERYGADALR
FALIYLATGGQDIRLD
Structures of the domain P96142 13-568
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gax X-ray 2.9 A 16-568 None
1gax X-ray 2.9 B 16-568 None
1ivs X-ray 2.9 A 16-568 None
1ivs X-ray 2.9 B 16-568 None


© NPIDB team 2003 - 2019

text