Pfam domain
Pfam family: Anticodon_1 (PF08264.12)
Uniprot AC: P96142
RecName: Valine--tRNA ligase
Begin-End: 607-748
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
DRFMRSRLSRGVEEITALYEALDLAQAAREVYELVWSEFCDWYLEAAKPALKAGNAHTLR
TLEEVLAVLLKLLHPMMPFLTSELYQALTGKEELALEAWPEPGGRDEEAERAFEALKQAV
TAVRALKAEAGLPPAQEVRVYL
Structures of the domain P96142 607-748
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gax X-ray 2.9 A 607-748 None
1gax X-ray 2.9 B 607-748 None
1ivs X-ray 2.9 A 607-748 None
1ivs X-ray 2.9 B 607-748 None


© NPIDB team 2003 - 2019

text