Pfam domain
Pfam family: Val_tRNA-synt_C (PF10458.8)
Uniprot AC: P96142
RecName: Valine--tRNA ligase
Begin-End: 797-862
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
DVEEWRRRQEKRLKELLALAERSQRKLASPGFREKAPKEVVEAEEARLKENLEQAERIRE
ALSQIG
Structures of the domain P96142 797-862
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1gax X-ray 2.9 A 797-861 None
1gax X-ray 2.9 B 797-861 None
1ivs X-ray 2.9 A 797-861 None
1ivs X-ray 2.9 B 797-861 None


© NPIDB team 2003 - 2019

text