Pfam domain
Pfam family: PemK_toxin (PF02452.16)
Uniprot AC: P96622
RecName: Endoribonuclease EndoA
Begin-End: 4-111
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
KRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEID
AKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISL
Structures of the domain P96622 4-111
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4mdx X-ray 1.5 A 4-111 None
4mdx X-ray 1.5 B 4-111 None


© NPIDB team 2003 - 2019

text