Pfam domain
Pfam family: MH1 (PF03165.15)
Uniprot AC: P97471
RecName: Mothers against decapentaplegic homolog 4
Begin-End: 36-136
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
AKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIY
ARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERV
Structures of the domain P97471 36-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3qsv X-ray 2.71 C 37-136  S-Bb S-Mj L-Bb L-Mj 
3qsv X-ray 2.71 B 37-137  H-Bb S-Bb S-Mj L-Bb L-Mj 
3qsv X-ray 2.71 D 37-136 None
3qsv X-ray 2.71 A 37-137 None


© NPIDB team 2003 - 2019

text