Pfam domain
Pfam family: Forkhead (PF00250.17)
Uniprot AC: P98177
RecName: Forkhead box protein O4
Begin-End: 102-181
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
GNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLH
SKFIKVHNEATGKSSWWMLN
Structures of the domain P98177 102-181
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l2c X-ray 1.87 A 100-176  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text