Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.20)
Uniprot AC: P9WG44
RecName: DNA gyrase subunit B
Begin-End: 602-664
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb 

Sequence:
NKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRS
FIT
Structures of the domain P9WG44 602-664
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5btl X-ray 2.5 D 606-663  H-Bb 
5btl X-ray 2.5 B 606-663  H-Bb 


© NPIDB team 2003 - 2019

text