Pfam domain
Pfam family: Toprim (PF01751.21)
Uniprot AC: P9WG45
RecName: DNA gyrase subunit B
Begin-End: 454-566
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
ELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGI
HDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQP
Structures of the domain P9WG45 454-566
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5btg X-ray 2.5 D 454-564  H-Bb S-Bb L-Bb L-Mn 
5btg X-ray 2.5 B 454-564  H-Bb S-Bb L-Bb L-Mn 
5bta X-ray 2.55 D 454-564  H-Bb S-Bb L-Bb L-Mn 
5bta X-ray 2.55 B 454-564  H-Bb S-Bb L-Bb L-Mn 
5bti X-ray 2.5 D 454-564  H-Bb S-Bb L-Bb L-Mn 
5bti X-ray 2.5 B 454-564  H-Bb S-Bb L-Bb L-Mn 
5btn X-ray 2.5 D 454-564  H-Bb S-Bb L-Bb L-Mn 
5btn X-ray 2.5 B 454-564  H-Bb S-Bb L-Bb L-Mn 
5bs8 X-ray 2.4 D 454-564  H-Bb S-Bb L-Bb L-Mn 
5bs8 X-ray 2.4 B 454-564  H-Bb S-Bb L-Bb L-Mn 
5btd X-ray 2.5 D 454-564  H-Bb S-Bb L-Bb 
5btd X-ray 2.5 B 454-564  H-Bb S-Bb L-Bb L-Mn 
5btf X-ray 2.61 D 454-564  H-Bb S-Bb L-Bb 
5btf X-ray 2.61 B 454-564  H-Bb S-Bb L-Bb 
5btc X-ray 2.55 D 454-564  H-Bb S-Bb L-Bb 
5btc X-ray 2.55 B 454-564  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text