Pfam domain
Pfam family: DNA_gyraseB_C (PF00986.20)
Uniprot AC: P9WG45
RecName: DNA gyrase subunit B
Begin-End: 602-664
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb 

Sequence:
NKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRS
FIT
Structures of the domain P9WG45 602-664
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5btg X-ray 2.5 D 606-663  H-Bb 
5btg X-ray 2.5 B 606-663  H-Bb 
5bta X-ray 2.55 B 606-663  H-Bb 
5bta X-ray 2.55 D 606-663  H-Bb 
5bti X-ray 2.5 D 606-663  H-Bb 
5bti X-ray 2.5 B 606-663  H-Bb 
5btn X-ray 2.5 D 606-663  H-Bb 
5btn X-ray 2.5 B 606-663  H-Bb 
5bs8 X-ray 2.4 D 606-663  H-Bb 
5bs8 X-ray 2.4 B 606-663  H-Bb 
5btd X-ray 2.5 D 606-663  H-Bb 
5btd X-ray 2.5 B 606-663  H-Bb 
5btf X-ray 2.61 D 606-663  H-Bb 
5btf X-ray 2.61 B 606-663  H-Bb 
5btc X-ray 2.55 D 606-663  H-Bb 
5btc X-ray 2.55 B 606-663  H-Bb 


© NPIDB team 2003 - 2019

text