Pfam domain
Pfam family: DNA_topoisoIV (PF00521.19)
Uniprot AC: P9WG47
RecName: DNA gyrase subunit A
Begin-End: 39-484
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 

Sequence:
RALPEVRDGLKPVHRRVLYAMFDSGFRPDRSHAKSARSVAETMGNYHPHGDASIYDSLVR
MAQPWSLRYPLVDGQGNFGSPGNDPPAAMRYTEARLTPLAMEMLREIDEETVDFIPNYDG
RVQEPTVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVFWALENHDADEEETLAA
VMGRVKGPDFPTAGLIVGSQGTADAYKTGRGSIRMRGVVEVEEDSRGRTSLVITELPYQV
NHDNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVIEIKRDAVAKVVINNLYKHTQLQ
TSFGANMLAIVDGVPRTLRLDQLIRYYVDHQLDVIVRRTTYRLRKANERAHILRGLVKAL
DALDEVIALIRASETVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQRIIDDLAKI
EAEIADLEDILAKPERQRGIVRDELA
Structures of the domain P9WG47 39-484
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5btg X-ray 2.5 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btg X-ray 2.5 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btl X-ray 2.5 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btl X-ray 2.5 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5bta X-ray 2.55 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5bta X-ray 2.55 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5bti X-ray 2.5 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5bti X-ray 2.5 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btn X-ray 2.5 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btn X-ray 2.5 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5bs8 X-ray 2.4 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5bs8 X-ray 2.4 C 39-483  H-Bb S-Bb S-Mj S-Mn L-Bb 
5btd X-ray 2.5 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btd X-ray 2.5 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btf X-ray 2.61 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btf X-ray 2.61 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btc X-ray 2.55 C 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 
5btc X-ray 2.55 A 39-483  H-Bb H-Mj S-Bb S-Mj S-Mn L-Bb 


© NPIDB team 2003 - 2019

text