Pfam domain
Pfam family: Sigma70_r4_2 (PF08281.14)
Uniprot AC: P9WGH9
RecName: ECF RNA polymerase sigma factor SigH
Begin-End: 138-191
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
DTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQL
Structures of the domain P9WGH9 138-191
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6koq X-ray 3.35 F 138-191 None
5zx2 X-ray 2.8 F 138-191  H-Bb H-Mj L-Bb 
6kop X-ray 3.3 F 138-191 None
6koo X-ray 2.8 F 138-191 None
6kon X-ray 3 F 138-191 None
6jcx X-ray 2.9 F 138-191 None


© NPIDB team 2003 - 2021

text