Pfam domain
Pfam family: Sigma70_r4_2 (PF08281.14)
Uniprot AC: P9WGH9
RecName: ECF RNA polymerase sigma factor SigH
Begin-End: 146-191
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
QALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQL
Structures of the domain P9WGH9 146-191
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6jcy X-ray 3.11 F 131-182 None


© NPIDB team 2003 - 2021

text