Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: P9WGH9
RecName: ECF RNA polymerase sigma factor SigH
Begin-End: 35-100
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj 

Sequence:
PLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSY
RKKQRQ
Structures of the domain P9WGH9 35-100
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zx2 X-ray 2.8 F 35-100  H-Bb H-Mj 
6kop X-ray 3.3 F 35-100 None
6koo X-ray 2.8 F 35-100 None
6kon X-ray 3 F 35-100 None
6jcx X-ray 2.9 F 35-100 None


© NPIDB team 2003 - 2021

text