Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P9WGI1
RecName: RNA polymerase sigma factor SigA
Begin-End: 374-451
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
EVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDS
QLGDFIEDSEAVVAVDAV
Structures of the domain P9WGI1 374-451
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 F 374-451 None
6vw0 X-ray 3.59 F 374-451  H-Bb H-Mj 
5uhb X-ray 4.29 F 374-451 None
6vvx X-ray 3.39 F 374-451 None
5uh8 X-ray 4.18 F 374-451 None
5uh5 X-ray 3.75 F 374-451 None
5uha X-ray 3.91 F 374-451 None
6c04 X-ray 3.27 F 374-451 None
6eec X-ray 3.55 F 374-451 None
5uh9 X-ray 4.4 F 374-451 None
6m7j X-ray 4.4 F 374-451  H-Mj 
5uhd X-ray 4.01 F 374-451 None
6edt X-ray 0 F 374-451  H-Bb 
5uh6 X-ray 3.84 F 374-451 None
5uhe X-ray 4.04 F 374-451 None
6bzo X-ray 3.38 F 374-451 None
5uhg X-ray 3.97 F 374-451 None
5uhc X-ray 3.8 F 374-451 None
6ee8 X-ray 3.92 F 374-451 None
6vvy X-ray 3.42 F 374-451  H-Bb 
6vvz X-ray 3.72 F 374-451 None


© NPIDB team 2003 - 2021

text