Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.21)
Uniprot AC: P9WGY5
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 42-105
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
ELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHA
DLLE
Structures of the domain P9WGY5 42-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 E 42-104 None
5uh8 X-ray 4.18 E 42-104 None
5uha X-ray 3.91 E 42-104 None
5uhb X-ray 4.29 E 42-104 None
5uh9 X-ray 4.4 E 42-104 None
5uh5 X-ray 3.75 E 42-104 None
5uhd X-ray 4.01 E 42-104 None
5uh6 X-ray 3.84 E 42-104 None
5uhe X-ray 4.04 E 42-104 None
5uhg X-ray 3.97 E 42-104 None
5uhc X-ray 3.8 E 42-104 None


© NPIDB team 2003 - 2019

text