Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 4-417
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
VNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCG
KYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPK
DLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVEDQRDGELEARAQKLEADLAE
LEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENLYRE
LVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQ
QSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAP
EIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNL
Structures of the domain P9WGY7 4-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 D 7-417 None
5uh8 X-ray 4.18 D 7-417 None
5uha X-ray 3.91 D 7-417 None
5uhb X-ray 4.29 D 7-417 None
5uh9 X-ray 4.4 D 7-417 None
5uh5 X-ray 3.75 D 7-417 None
5uhd X-ray 4.01 D 7-417 None
5uh6 X-ray 3.84 D 7-417 None
5uhe X-ray 4.04 D 7-417 None
5uhg X-ray 3.97 D 7-417 None
5uhc X-ray 3.8 D 7-417 None


© NPIDB team 2003 - 2019

text