Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: P9WGY7
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 843-1218
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
GLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCQTERGIVVELA
ERAPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVERGQDLGDPEIDALLAAGITQVKV
RSVLTCATSTGVCATCYGRSMATGKLVDIGEAVGIVAAQSIGEPGTQLTMRTFHQGGVGE
DITGGLPRVQELFEARVPRGKAPIADVTGRVRLEDGERFYKITIVPDDGGEEVVYDKISK
RQRLRVFKHEDGSERVLSDGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVY
RAQGVSIHDKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEPAA
GRPVLMGITKASLATD
Structures of the domain P9WGY7 843-1218
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6vw0 X-ray 3.59 D 843-1218  H-Bb L-Bb 
6edt X-ray 0 D 843-1218 None
6vvy X-ray 3.42 D 843-1218 None


© NPIDB team 2003 - 2021

text