Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: P9WGY9
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1064-1140
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
GGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKV
LLKELQSLCLNVEVLSS
Structures of the domain P9WGY9 1064-1140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 C 1064-1138 None
5uh8 X-ray 4.18 C 1064-1138 None
5uha X-ray 3.91 C 1064-1138 None
5uhb X-ray 4.29 C 1064-1138 None
5uh9 X-ray 4.4 C 1064-1138 None
5uh5 X-ray 3.75 C 1064-1138 None
5uhd X-ray 4.01 C 1064-1138 None
5uh6 X-ray 3.84 C 1064-1138 None
5uhe X-ray 4.04 C 1064-1138 None
5uhg X-ray 3.97 C 1064-1138 None
5uhc X-ray 3.8 C 1064-1138 None


© NPIDB team 2003 - 2019

text