Pfam domain
Pfam family: RNA_pol_L (PF01193.23)
Uniprot AC: P9WGZ1
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 24-219
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
EPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNLKSL
VVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERG
RGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSIS
PRDALASAGKTLVELF
Structures of the domain P9WGZ1 24-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uhf X-ray 4.35 A 24-218 None
5uhf X-ray 4.35 B 24-218 None
5uh8 X-ray 4.18 A 24-218 None
5uh8 X-ray 4.18 B 24-218 None
5uha X-ray 3.91 A 24-218 None
5uha X-ray 3.91 B 24-218 None
5uhb X-ray 4.29 B 24-218 None
5uhb X-ray 4.29 A 24-218 None
5uh9 X-ray 4.4 B 24-218 None
5uh9 X-ray 4.4 A 24-218 None
5uh5 X-ray 3.75 B 24-218 None
5uh5 X-ray 3.75 A 24-218 None
5uhd X-ray 4.01 A 24-218 None
5uhd X-ray 4.01 B 24-218 None
5uh6 X-ray 3.84 A 24-218 None
5uh6 X-ray 3.84 B 24-218 None
5uhe X-ray 4.04 B 24-218 None
5uhe X-ray 4.04 A 24-218 None
5uhg X-ray 3.97 B 24-218 None
5uhg X-ray 3.97 A 24-218 None
5uhc X-ray 3.8 B 24-218 None
5uhc X-ray 3.8 A 24-218 None


© NPIDB team 2003 - 2019

text