Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: P9WH81
RecName: 50S ribosomal protein L6
Begin-End: 91-166
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
FGVGYRVQLKGSNLEFALGYSHPVVIEAPEGITFAVQAPTKFTVSGIDKQKVGQIAANIR
RLRRPDPYKGKGVRYE
Structures of the domain P9WH81 91-166
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 G 91-165 None


© NPIDB team 2003 - 2019

text