Pfam domain
Pfam family: Ribosomal_L5 (PF00281.18)
Uniprot AC: P9WH83
RecName: 50S ribosomal protein L5
Begin-End: 31-87
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
NVMQIPTVTKVVVNMGVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLR
Structures of the domain P9WH83 31-87
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 F 31-87 None


© NPIDB team 2003 - 2019

text