Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: P9WH87
RecName: 50S ribosomal protein L3
Begin-End: 85-214
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
RLDDSDAATEYQVGQELTAEIFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAV
HRRPGSIGGCATPARVFKGTRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGG
LVMVRSAIKR
Structures of the domain P9WH87 85-214
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 D 92-187 None


© NPIDB team 2003 - 2019

text