Pfam domain
Pfam family: Ribosomal_L36 (PF00444.17)
Uniprot AC: P9WH89
RecName: 50S ribosomal protein L36
Begin-End: 1-37
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG
Structures of the domain P9WH89 1-37
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 4 2-37 None


© NPIDB team 2003 - 2019

text