Pfam domain
Pfam family: Ribosomal_L35p (PF01632.18)
Uniprot AC: P9WH91
RecName: 50S ribosomal protein L35
Begin-End: 2-62
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
PKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVAANDTKRVTSL
L
Structures of the domain P9WH91 2-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 3 2-62 None


© NPIDB team 2003 - 2019

text