Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: P9WH93
RecName: 50S ribosomal protein L34
Begin-End: 4-45
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
GKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTL
Structures of the domain P9WH93 4-45
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 2 5-45 None


© NPIDB team 2003 - 2019

text