Pfam domain
Pfam family: Ribosomal_L32p (PF01783.22)
Uniprot AC: P9WH99
RecName: 50S ribosomal protein L32
Begin-End: 2-50
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
AVPKRRKSRSNTRSRRSQWKAAKTELVGVTVAGHAHKVPRRLLKAARLG
Structures of the domain P9WH99 2-50
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 0 2-46 None


© NPIDB team 2003 - 2019

text