Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: P9WHA5
RecName: 50S ribosomal protein L2
Begin-End: 42-119
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
GRNAHGRITTRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDGE
KRYIIAPNGLSQGDVVES
Structures of the domain P9WHA5 42-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 C 42-119 None


© NPIDB team 2003 - 2019

text