Pfam domain
Pfam family: Ribosomal_L27 (PF01016.18)
Uniprot AC: P9WHB3
RecName: 50S ribosomal protein L27
Begin-End: 12-80
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
NGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDTLFAKTAGAVEFGI
KRGRKTVSI
Structures of the domain P9WHB3 12-80
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 W 12-80 None


© NPIDB team 2003 - 2019

text