Pfam domain
Pfam family: ribosomal_L24 (PF17136.3)
Uniprot AC: P9WHB7
RecName: 50S ribosomal protein L24
Begin-End: 38-104
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
VNRIKKHTAISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRI
SKRNGKD
Structures of the domain P9WHB7 38-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 U 46-103 None


© NPIDB team 2003 - 2019

text