Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: P9WHC1
RecName: 50S ribosomal protein L22
Begin-End: 15-118
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
AKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAPQAASGPVAKVIASAAANAQNNGGL
DPATLVVATVYADQGPTAKRIRPRAQGRAFRIRRRTSHITVVVE
Structures of the domain P9WHC1 15-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 S 15-117 None


© NPIDB team 2003 - 2019

text