Pfam domain
Pfam family: Ribosomal_L20 (PF00453.17)
Uniprot AC: P9WHC5
RecName: 50S ribosomal protein L20
Begin-End: 3-109
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
RVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKLWI
ARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTAL
Structures of the domain P9WHC5 3-109
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 Q 3-109 None


© NPIDB team 2003 - 2019

text