Pfam domain
Pfam family: Ribosomal_L19 (PF01245.19)
Uniprot AC: P9WHC9
RecName: 50S ribosomal protein L19
Begin-End: 2-112
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
NRLDFVDKPSLRDDIPAFNPGDTINVHVKVIEGAKERLQVFKGVVIRRQGGGIRETFTVR
KESYGVGVERTFPVHSPNIDHIEVVTRGDVRRAKLYYLRELRGKKAKIKEK
Structures of the domain P9WHC9 2-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 P 6-112 None


© NPIDB team 2003 - 2019

text