Pfam domain
Pfam family: Ribosomal_L17 (PF01196.18)
Uniprot AC: P9WHD3
RecName: 50S ribosomal protein L17
Begin-End: 20-116
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
ILANLATSLFEHGRITTTEPKARALRPYAEKLITHAKKGALHNRREVLKKLRDKDVVHTL
FAEIGPFFADRDGGYTRIIKIEARKGDNAPMAVIELV
Structures of the domain P9WHD3 20-116
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5v7q X-ray 3.7 N 21-116 None


© NPIDB team 2003 - 2019

text