Pfam domain
Pfam family: RbpA (PF13397.8)
Uniprot AC: P9WHJ5
RecName: RNA polymerase-binding protein RbpA
Begin-End: 4-106
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
RVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGT
LIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERLELIR
Structures of the domain P9WHJ5 4-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6vw0 X-ray 3.59 J 4-106  L-Bb 
6vvx X-ray 3.39 J 4-106  L-Bb 
6c04 X-ray 3.27 J 4-106 None
6eec X-ray 3.55 J 4-106  L-Bb 
6m7j X-ray 4.4 J 4-106  L-Bb 
6edt X-ray 0 J 4-106  L-Bb 
6bzo X-ray 3.38 J 4-106  L-Bb 
6ee8 X-ray 3.92 J 4-106  L-Bb 
6vvy X-ray 3.42 J 4-106  L-Bb 
6vvz X-ray 3.72 J 4-106  L-Bb 


© NPIDB team 2003 - 2021

text