Pfam domain
Pfam family: PemK_toxin (PF02452.16)
Uniprot AC: P9WII3
RecName: Endoribonuclease MazF6
Begin-End: 4-112
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
SRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFL
PATTTRLPRDSVVNVTAIVTLNKTDLTDRVGEVPASLMHEVDRGLRRVL
Structures of the domain P9WII3 4-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hk3 X-ray 1.56 A 5-111 None
5hk3 X-ray 1.56 B 5-111 None
5hk0 X-ray 2.25 A 5-111 None
5hk0 X-ray 2.25 B 5-111 None
5hk0 X-ray 2.25 D 5-111 None
5hk0 X-ray 2.25 C 5-111 None


© NPIDB team 2003 - 2019

text